• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> HSP90 beta Antibody / HSP90AB1

HSP90 beta Antibody / HSP90AB1 (R31913)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31913 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat testis, 2) rat thymus, 3) human placenta, 4) SW620 and 5) HeLa lysate with HSP90 beta antibody. Expected/observed molecular weight: 84-90 kDa.
›
Western blot testing of 1) rat testis, 2) rat thymus, 3) human placenta, 4) SW620 and 5) HeLa lysate with HSP90 beta antibody. Expected/observed molecular weight: 84-90 kDa.
IHC testing of FFPE human placenta with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse testis with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat testis with HSP90 beta antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of human lung cancer with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of human lung cancer with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of mouse brain with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of mouse brain with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear counterstain. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IF/ICC staining of FFPE human A431 cells with HSP90 beta antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P08238
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
Immunofluorescence : 2-4ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunofluorescence/Immunocytochemistry (FFPE) : 2-4ug/ml
Limitations This HSP90 beta antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.

Application Notes

Optimal dilution of the HSP90 beta antibody should be determined by the researcher.

Immunogen

Amino acids RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK of human HSP90AB1 were used as the immunogen for the Hsp90 beta antibody.

Storage

After reconstitution, the HSP90 beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Hsp90 beta antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.