- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Hsp90 beta Antibody / Heat Shock Protein 90 Beta Antibody detects HSP90AB1, a constitutively expressed member of the heat shock protein 90 family that functions as an ATP-dependent molecular chaperone. Unlike the stress-inducible HSP90 alpha isoform, Hsp90 beta is continuously expressed in most cell types and plays an essential role in maintaining protein stability, folding newly synthesized proteins and preserving cellular protein homeostasis. Because of its broad expression and critical housekeeping functions, Hsp90 beta is widely studied in cell biology, cancer research and molecular chaperone biology.
Heat Shock Protein 90 Beta interacts with an extensive network of client proteins, including protein kinases, transcription factors, steroid hormone receptors and signaling molecules that regulate cell growth, differentiation, apoptosis and intracellular communication. Together with numerous co-chaperones, Hsp90 beta facilitates correct protein folding, prevents aggregation of misfolded proteins and promotes the functional maturation of proteins required for normal cellular activity. Hsp90 beta Antibody is therefore an important tool for investigating protein quality control and signal transduction pathways.
Although Hsp90 beta is constitutively expressed under normal physiological conditions, its activity becomes particularly important during cellular stress, where maintenance of protein stability is essential for survival. Dysregulation of HSP90AB1 has been associated with cancer progression, neurodegenerative disorders, inflammatory diseases and altered responses to environmental stress. Because many oncogenic proteins depend upon Hsp90 beta for stability, this molecular chaperone remains an important focus of therapeutic research in oncology and translational medicine.
The high sequence similarity shared among HSP90 family members makes antibody specificity especially important for reliable experimental results. Careful detection of HSP90AB1 allows researchers to distinguish constitutive Hsp90 beta expression from related heat shock protein isoforms while examining protein homeostasis, cellular signaling and stress response mechanisms. Hsp90 beta Antibody / Heat Shock Protein 90 Beta Antibody supports applications including Western blot, immunohistochemistry, immunofluorescence and flow cytometry across a wide range of human and animal tissues.
NSJ Bioreagents offers Hsp90 beta Antibody / Heat Shock Protein 90 Beta Antibody products for researchers studying molecular chaperone biology, protein folding and cellular stress responses. These antibodies provide reliable tools for analyzing HSP90AB1 expression, intracellular localization and disease-associated changes in protein homeostasis.
Researchers studying HSP90 beta and cellular protein folding may also be interested in our HSP90AB1 Antibody / Molecular Chaperone Antibody page, featuring a Protein Microarray Validated mouse monoclonal antibody for highly specific detection of HSP90AB1.
Optimal dilution of the Hsp90 beta Antibody / Heat Shock Protein 90 Beta Antibody should be determined by the researcher.
Amino acids 449-481 (RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK) from the human protein were used as the immunogen for the Hsp90 beta antibody.
After reconstitution, the Hsp90 beta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
HSP90AB1 antibody, HSP90B antibody, HSP84 antibody, HSPCB antibody, HSP90 Beta Cytosolic antibody, Molecular Chaperone antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.