• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HRAS Antibody

HRAS Antibody (R31862)

  Catalog No Formulation Size Price (USD)  
Image R31862 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse brain, and 3) mouse HEPA lysate with HRAS antibody. Expected/observed molecular weight ~21 kDa.
IHC staining of FFPE mouse intestine with HRAS antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P01112
Applications Western Blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This HRAS antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, IF, ELISA
    Reactivity : Human, Mouse
    Pred. Reactivity : Rat, Chicken
  • Applications : WB, IHC, IF, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat
  • Applications : WB, ELISA
    Reactivity : Mouse
    Pred. Reactivity : Human, Rat, Chicken
  • Applications : WB
    Reactivity : Human, Mouse
  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Zebrafish

Description

GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

Application Notes

Optimal dilution of the HRAS antibody should be determined by the researcher.

Immunogen

Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.

Storage

After reconstitution, the HRAS antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.