- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
HOXB1 Antibody (C-Terminal Region) (R32961)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32961 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| UniProt | P14653 |
| Applications | Western Blot : 0.5-1ug/ml |
| Limitations | This HOXB1 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.
Optimal dilution of the HOXB1 antibody should be determined by the researcher.
Amino acids 176-220 (TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK) were used as the immunogen for the HOXB1 antibody.
After reconstitution, the HOXB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz