• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HNRNPA2B1 Antibody

HNRNPA2B1 Antibody (RQ4393)

  Catalog No Formulation Size Price (USD)  
Image RQ4393 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Immunofluorescent staining of FFPE human U-2 OS cells with HNRNPA2B1 antibody (red) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) placenta, 3) MDA-MB-453, 4) SW620, 5) HepG2, 6) 22RV1, 7) A431 and 8) A375 lysate with HNRNPA2B1 antibody at 0.5ug/ml. Predicted molecular weight: ~36 kDa.
Flow cytometry testing of human A431 cells with HNRNPA2B1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HNRNPA2B1 antibody.
IHC staining of FFPE human intestinal cancer with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with HNRNPA2B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P22626
Localization Nuclear
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescence : 2-4ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This HNRNPA2B1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC, ELISA (peptide)
    Reactivity : Human, Mouse
    Pred. Reactivity : Cow, Dog, Pig, Rat

Description

Heterogeneous nuclear ribonucleoproteins A2/B1 is a protein that in humans is encoded by the HNRNPA2B1 gene. This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.

Application Notes

Optimal dilution of the HNRNPA2B1 antibody should be determined by the researcher.

Immunogen

Amino acids KTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKL from the human protein were used as the immunogen for the HNRNPA2B1 antibody.

Storage

After reconstitution, the HNRNPA2B1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.