• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> HMGB1 Antibody

HMGB1 Antibody [clone 5H3] (RQ5513)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ5513 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
IHC staining of FFPE human breast cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
›
IHC staining of FFPE human breast cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human intestinal cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Western blot testing of 1) human HepG2, 2) human CCRF-CEM, 3) monkey COS-7, 4) human SW620, 5) human ThP-1, 6) rat PC-12, 7) rat RH35 and 8) mouse NIH3T3 with HMGB1 antibody. Predicted molecular weight ~25 kDa.
Flow cytometry testing of human SiHa cells with HMGB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMGB1 antibody.
IHC staining of FFPE mouse brain with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with HMGB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat, Monkey
Format Antigen affinity purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 5H3
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P09429
Localization Nuclear, cytoplasmic, cell membrane, extracellular
Applications Western blot : 0.5-1ug/ml
Flow cytometry : 1-3ug/million cells
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This HMGB1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse
  • Applications : IHC, WB, ELISA
    Reactivity : Human, Mouse
    Pred. Reactivity : Rat, Bovine, Pig, Primate, Hamster
  • Applications : IHC-P, WB
    Reactivity : Human, Rat
    Rab Mono Image
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Primate
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Pig, Primate, Hamster
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat

Description

High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

Application Notes

Optimal dilution of the HMGB1 antibody should be determined by the researcher.

Immunogen

Amino acids DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK were used as the immunogen for the HMGB1 antibody.

Storage

After reconstitution, the HMGB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all HMGB1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.