• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HMG4 Antibody / HMGB3

HMG4 Antibody / HMGB3 [clone 8H9] (RQ6028)

  Catalog No Formulation Size Price (USD)  
Image RQ6028 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Immunofluorescent staining of FFPE human HeLa cells with HMG4 antibody. HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) placenta, 2) HeLa, 3) T-47D, 4) HepG2, 5) Caco-2, 6) SW620 and 7) Raji lysate with HMG4 antibody. Predicted molecular weight ~23 kDa.
Western blot testing of 1) rat brain, 2) rat liver and 3) mouse ANA-1 lysate with HMG4 antibody. Predicted molecular weight ~23 kDa.
Flow cytometry testing of human HeLa cells with HMG4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HMG4 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 8H9
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O15347
Localization Nuclear, cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Immunofluorescence : 2-4ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This HMG4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
    Recrabbitmono
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Chicken, Mouse
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Cow, Mouse
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat

Description

High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the HMG4 antibody should be determined by the researcher.

Immunogen

Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMG4 antibody.

Storage

After reconstitution, the HMG4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.