HLA-DQB1 Antibody | HLA-DQ Beta 1 Chain Antibody

	Catalog No	Formulation	Size	Price (USD)
	RQ4155	0.5mg/ml if reconstituted with 0.2ml sterile DI water	100 ug	449
Formulation

HLA-DQB1 Antibody in Human MCF-7 Breast Cancer Cells IF. Immunofluorescence staining of FFPE human MCF-7 breast cancer cells with HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody (green) and DAPI nuclear stain (blue). HIER was performed by steaming the sections in citrate buffer, pH 6, for 20 min. HLA-DQB1 immunoreactivity is distributed throughout the cells with prominent peripheral and cytoplasmic staining and relative exclusion from the nuclei.

HLA-DQB1 Antibody in Human Kidney IHC. Immunohistochemistry testing of HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody in FFPE human kidney tissue using an HRP-conjugated secondary antibody and DAB substrate. HIER was performed by boiling tissue sections in EDTA buffer, pH 8, for 20 min followed by cooling prior to testing. Moderate HLA-DQB1 immunoreactivity is observed predominantly in renal tubular epithelial cells, while glomeruli show comparatively little staining.

›

HLA-DQB1 Antibody in Human MCF-7 Breast Cancer Cells IF. Immunofluorescence staining of FFPE human MCF-7 breast cancer cells with HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody (green) and DAPI nuclear stain (blue). HIER was performed by steaming the sections in citrate buffer, pH 6, for 20 min. HLA-DQB1 immunoreactivity is distributed throughout the cells with prominent peripheral and cytoplasmic staining and relative exclusion from the nuclei.

HLA-DQB1 Antibody in Human SK-OV-3 Ovarian Cancer Cells WB. Western blot testing of HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody with human SK-OV-3 ovarian cancer cell lysate at 0.5 ug/ml. A strong, discrete band is detected at approximately 30 kDa, consistent with the predicted molecular weight of HLA-DQB1.

HLA-DQB1 Antibody in Human Kidney IHC. Immunohistochemistry testing of HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody in FFPE human kidney tissue using an HRP-conjugated secondary antibody and DAB substrate. HIER was performed by boiling tissue sections in EDTA buffer, pH 8, for 20 min followed by cooling prior to testing. Moderate HLA-DQB1 immunoreactivity is observed predominantly in renal tubular epithelial cells, while glomeruli show comparatively little staining.

Availability	1-3 business days
Species Reactivity	Human
Format	Antigen affinity purified
Host	Rabbit
Clonality	Polyclonal (rabbit origin)
Isotype	Rabbit IgG
Purity	Antigen affinity purified
Buffer	Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt	P01920
Applications	Western Blot : 0.5-1ug/ml Immunofluorescence : 5ug/ml Immunohistochemistry (FFPE) : 2-5ug/ml
Limitations	This HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody is available for research use only.
	Review this product on BioCompare and get a $20 Amazon gift card

Description

HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody targets HLA-DQB1, a highly polymorphic major histocompatibility complex (MHC) class II protein that forms a beta-chain component of HLA-DQ. Functional HLA-DQ molecules consist of non-covalently associated alpha and beta chains that cooperate in the presentation of processed antigenic peptides to CD4-positive T lymphocytes. The HLA-DQB1 beta chain commonly associates with an HLA-DQA1 alpha chain to form a cell-surface HLA-DQ heterodimer involved in adaptive immune recognition.

HLA-DQB1 is located within the MHC class II region on chromosome 6 and exhibits extensive allelic variation. The extracellular domains of the HLA-DQ alpha and beta chains together form the peptide-binding groove, with polymorphic residues strongly influencing which peptides can be accommodated and presented. Different combinations of HLA-DQA and HLA-DQB proteins therefore generate HLA-DQ heterodimers with distinct peptide-binding properties, contributing to substantial diversity in immune recognition among individuals.

HLA-DQ molecules participate in the MHC class II antigen-processing pathway used predominantly by professional antigen-presenting cells such as B lymphocytes, dendritic cells and macrophages. Internalized proteins are processed within intracellular compartments, and selected peptides are loaded onto class II molecules before mature peptide-HLA-DQ complexes are transported to the plasma membrane. Recognition of these complexes by T cell receptors together with the CD4 co-receptor contributes to helper T cell activation and antigen-specific immune responses.

HLA-DQB1 is particularly important in immunogenetics because specific DQB1 alleles and their pairing with HLA-DQA alleles are associated with susceptibility or resistance to multiple immune-mediated conditions. An HLA-DQB1 Antibody provides a chain-focused approach to studying the HLA-DQ system and complements antibodies recognizing HLA-DQA1, the assembled HLA-DQ antigen or broader MHC class II determinants. HLA-DQB1 is relevant to research involving antigen presentation, autoimmunity, transplantation, infectious disease and adaptive immune regulation.

NSJ Bioreagents provides this HLA-DQB1 Antibody for research into the beta-chain component of HLA-DQ, MHC class II biology and antigen presentation. An HLA-DQ Beta 1 Chain Antibody can support investigation of HLA-DQB1 expression and the contribution of HLA-DQ beta-chain variation to peptide presentation and CD4 T cell-mediated immune recognition.

Explore our Immunology Antibodies page for additional reagents targeting MHC molecules, antigen presentation and adaptive immune responses.

Application Notes

Optimal dilution of the HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody should be determined by the researcher.

Immunogen

Amino acids DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR were used as the immunogen for the HLA-DQB1 antibody.

Storage

After reconstitution, the HLA-DQB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

HLA-DQB1 antibody, HLA-DQ Beta 1 Chain antibody, HLA-DQ Beta Chain antibody, MHC Class II DQ Beta antibody, DQB1 antibody

Related Products

1. View all HLA-DQB1 antibodies

HLA-DQB1 Antibody / HLA-DQ Beta 1 Chain Antibody (RQ4155)

Description

Application Notes

Immunogen

Storage

Alternate Names

Related Products

Area of Research

Product Type

Protocols

Contact Us

NSJ Bioreagents