- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.
Optimal dilution of the HKDC1 antibody should be determined by the researcher.
Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.
After reconstitution, the HKDC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.