• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HKDC1 Antibody

HKDC1 Antibody (R32256)

  Catalog No Formulation Size Price (USD)  
Image R32256 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) 293, 2) SW620, 3) COLO320 and 4) HeLa cell lysate with HKDC1 antibody. Expected molecular weight: ~103 kDa, observed here at ~170 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q2TB90
Applications Western Blot : 0.1-0.5ug/ml
Limitations This HKDC1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

HKDC1 (hexokinase domain containing 1) is a protein that belongs to the hexokinase family and functions to catalyze the ATP-dependent conversion of D-hexose to D-hexose 6-phosphate.

Application Notes

Optimal dilution of the HKDC1 antibody should be determined by the researcher.

Immunogen

Amino acids KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD of human HKDC1 were used as the immunogen for the HKDC1 antibody.

Storage

After reconstitution, the HKDC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.