• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Heparanase 1 Antibody

Heparanase 1 Antibody (R32358)

  Catalog No Formulation Size Price (USD)  
Image R32358 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat liver, 2) human placenta, 3) A549 lysate with Heparanase 1 antibody. Predicted molecular weight: 61 kDa (isoform 1), ~53 kDa (isoform 2/3), ~43 kDa (isoform 4).
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q9Y251
Applications Western Blot : 0.1-0.5ug/ml
Limitations This Heparanase 1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Mouse

Description

Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.

Application Notes

Optimal dilution of the Heparanase 1 antibody should be determined by the researcher.

Immunogen

Amino acids NGRTATKEDFLNPDVLDIFISSVQKVFQVVE of human Heparanase 1 were used as the immunogen for the Heparanase 1 antibody.

Storage

After reconstitution, the Heparanase 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.