• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> GSK3 alpha Antibody / GSK3A

GSK3 alpha Antibody / GSK3A (RQ4122)

  Catalog No Formulation Size Price (USD)  
Image RQ4122 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat brain, 2) rat testis and 3) mouse testis lysate with GSK3 alpha antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Predicted Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P49840
Applications Western Blot : 0.5-1ug/ml
Limitations This GSK3 alpha antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Glycogen synthase kinase-3 alpha is an enzyme that in humans is encoded by the GSK3A gene. This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease.

Application Notes

Optimal dilution of the GSK3 alpha antibody should be determined by the researcher.

Immunogen

Amino acids QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR from the human protein were used as the immunogen for the GSK3 alpha antibody.

Storage

After reconstitution, the GSK3 alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.