• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> GRP75 Antibody / HSPA9

GRP75 Antibody / HSPA9 (R32087)

  Catalog No Formulation Size Price (USD)  
Image R32087 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Immunofluorescent staining of FFPE human HeLa cells with GRP75 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human lung cancer tissue with GRP75 antibody. HIER: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human intestinal cancer tissue with GRP75 antibody. HIER: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) human HeLa, 2) human A549, 3) human Jurkat, 4) human HepG2, 5) rat testis, 6) rat PC-12, 7) mouse testis and 8) mouse NIH 3T3 cell lysate with GRP75 antibody. Predicted molecular weight ~75 kDa.
Flow cytometry testing of human HL60 cells with GRP75 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= GRP75 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P38646
Localization Cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow Cytometry : 1-3ug/million cells
Immunofluorescence : 5ug/ml
Limitations This GRP75 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, IHC-F, ICC
    Reactivity : Human, Mouse, Rat

Description

HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.

Application Notes

Optimal dilution of the GRP75 antibody should be determined by the researcher.

Immunogen

Amino acids KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ of human HSPA9/GRP75 were used as the immunogen for the GRP75 antibody.

Storage

After reconstitution, the GRP75 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.