• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> GPR54 Antibody / KISS1R

GPR54 Antibody / KISS1R (RQ4294)

  Catalog No Formulation Size Price (USD)  
Image RQ4294 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) WISH and 2) HepG2 cell lysate with GPR54 antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q969F8
Localization Cell membrane
Applications Western Blot : 0.5-1ug/ml
Limitations This GPR54 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

The KiSS1-derived peptide receptor (also known as GPR54 or the Kisspeptin receptor) is a G protein-coupled receptor which binds the peptide hormone kisspeptin (metastin). Kisspeptin is involved in the regulation of endocrine function and the onset of puberty, with activation of the kisspeptin receptor triggering release of gonadotropin-releasing hormone (GnRH), and release of kisspeptin itself being inhibited by oestradiol but enhanced by GnRH. Reductions in kisspeptin levels with age may conversely be one of the reasons behind age-related declines in levels of other endocrine hormones such as luteinizing hormone.

Application Notes

Optimal dilution of the GPR54 antibody should be determined by the researcher.

Immunogen

Amino acids MLRHLGRVAVRPAPADSALQGQVLAERAGAVRAK were used as the immunogen for the GPR54 antibody.

Storage

After reconstitution, the GPR54 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.