- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
GPI Antibody recognizes phosphoglucose isomerase (GPI), a highly conserved glycolytic enzyme that catalyzes the reversible conversion of glucose 6-phosphate to fructose 6-phosphate, an essential step linking glucose uptake to cellular energy production. Because this reaction lies near the beginning of the glycolytic pathway, phosphoglucose isomerase plays a central role in carbohydrate metabolism and cellular bioenergetics. Beyond its intracellular enzymatic function, GPI also serves as a multifunctional secreted protein with cytokine-like activities under alternative names including autocrine motility factor and neuroleukin. NSJ Bioreagents supplies GPI Antibody for reliable detection of this versatile metabolic protein across numerous research applications.
Within cells, phosphoglucose isomerase supports glycolysis and gluconeogenesis by maintaining metabolic flux between phosphorylated glucose and fructose intermediates. When released extracellularly, however, the protein functions independently of its catalytic activity to regulate cell migration, proliferation, tissue remodeling, and neuronal survival. These distinct intracellular and extracellular functions have made GPI an important model for studying protein moonlighting, in which a single protein performs multiple unrelated biological roles. Consequently, GPI Antibody is widely used in studies of metabolism, cancer biology, neurobiology, and cell signaling.
Abnormal expression of phosphoglucose isomerase has been associated with numerous diseases, including breast, colorectal, gastric, pancreatic, and lung cancers, where elevated extracellular activity promotes tumor invasion and metastasis. GPI has also been implicated in autoimmune arthritis, inherited enzyme deficiencies resulting in chronic hemolytic anemia, and neurological disorders involving altered neuronal maintenance. Owing to its dual roles in metabolism and extracellular signaling, GPI continues to attract significant attention as both a disease biomarker and a potential therapeutic target. Researchers frequently employ GPI Antibody to investigate glycolytic regulation, tumor progression, immune responses, and mechanisms linking metabolism with cellular communication.
A GPI Antibody is a valuable reagent for investigating phosphoglucose isomerase function, glycolytic metabolism, extracellular signaling, and disease pathogenesis. By enabling reliable detection of this multifunctional enzyme, a GPI Antibody supports research into energy metabolism, cancer progression, neuronal biology, and the molecular pathways that connect metabolism with cell migration and survival.
For a broader overview of this multifunctional metabolic enzyme and additional validated reagents, visit our GPI Antibody / Glucose 6-Phosphate Isomerase Antibody page.
Differences in protocols and secondary/substrate sensitivity may require the GPI Antibody / Phosphoglucose Isomerase Antibody to be titrated for optimal performance.
Amino acids 5-39 (TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH) from the human protein were used as the immunogen for the GPI antibody.
After reconstitution, the GPI antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Glucose 6-Phosphate Isomerase antibody, Autocrine Motility Factor antibody, Neuroleukin antibody, Phosphohexose Isomerase antibody, Glucose Phosphate Isomerase antibody, AMF antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.