- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.
Optimal dilution of the GJC1 antibody should be determined by the researcher.
Amino acids 91-131 (YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE) from the human protein were used as the immunogen for the GJC1 antibody.
After reconstitution, the GJC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.