• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> GAT-1 Antibody / GABA Transporter 1 / SLC6A1 (N-Terminal Region)

GAT-1 Antibody / GABA Transporter 1 / SLC6A1 (N-Terminal Region) (R32967)

  Catalog No Formulation Size Price (USD)  
Image R32967 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain and 2) mouse brain lysate with GAT-1 antibody at 0.5ug/ml. Predicted molecular weight: 67~80 kDa depending on level of glycosylation.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Predicted Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P30531
Localization Membrane
Applications Western Blot : 0.5-1ug/ml
Limitations This GAT-1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

GABA transporter 1 (GAT1), also known as sodium- and chloride-dependent GABA transporter 1, is a protein that in humans is encoded by the SLC6A1 gene. GABA Transporter 1 uses Na+ and Cl- to create a gradient, which removes or adds GABA to extracellular spaces in the cerebrum and cerebellum. The stoichiometry for GABA Transporter 1 is 2 Na+: 1 Cl-: 1 GABA. The activity of GAT1 is largely dependent on the presence of Na+, while Cl- assists by increasing the ability for GAT-1 to uptake GABA.

Application Notes

Optimal dilution of the GAT-1 antibody should be determined by the researcher.

Immunogen

Amino acids 23-54 (ANDKPKTLVVKVQKKAADLPDRDTWKGRFDFL) were used as the immunogen for the GAT-1 antibody.

Storage

After reconstitution, the GAT-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.