• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Galectin 8 Antibody

Galectin 8 Antibody (R31785)

  Catalog No Formulation Size Price (USD)  
Image R31785 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) human COLO-320, 2) rat testis and 3) mouse Neuro-2A lysate with Galectin 8 antibody. Expected molecular weight ~36/40 kDa (isoforms 1/2).
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O00214
Applications Western Blot : 0.1-0.5ug/ml
Limitations This Galectin 8 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.

Application Notes

Optimal dilution of the Galectin 8 antibody should be determined by the researcher.

Immunogen

Amino acids HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW of human Galectin 8 were used as the immunogen for the Galectin 8 antibody.

Storage

After reconstitution, the Galectin 8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.