• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> GADD45G Antibody

GADD45G Antibody (RQ4429)

  Catalog No Formulation Size Price (USD)  
Image RQ4429 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HeLa, 2) placenta, 3) SW620, 4) A549 and 5) mouse NIH 3T3 lysate with GADD45G antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
Western blot testing of 1) rat brain, 2) rat heart, 3) rat testis, 4) rat skeletal muscle, 5) mouse brain, 6) mouse heart, 7) mouse testis and 8) mouse skeletal muscle lysate with GADD45G antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O95257
Applications Western Blot : 0.5-1ug/ml
Limitations This GADD45G antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Growth arrest and DNA-damage-inducible protein GADD45 gamma is a protein that in humans is encoded by the GADD45G gene on chromosome 9. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.

Application Notes

Optimal dilution of the GADD45G antibody should be determined by the researcher.

Immunogen

Amino acids MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ from the human protein were used as the immunogen for the GADD45G antibody.

Storage

After reconstitution, the GADD45G antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.