• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> GAD65 Antibody

GAD65 Antibody (R32760)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32760 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat brain and 2) mouse brain lysate with GAD65 antibody at 0.5ug/ml. Predicted molecular weight ~65 kDa.
›
Western blot testing of 1) rat brain and 2) mouse brain lysate with GAD65 antibody at 0.5ug/ml. Predicted molecular weight ~65 kDa.
IHC testing of FFPE human breast cancer tissue with GAD65 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human intestinal cancer tissue with GAD65 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat kidney tissue with GAD65 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q05329
Localization Cytoplasmic, membranous
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This GAD65 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.

Application Notes

Optimal dilution of the GAD65 antibody should be determined by the researcher.

Immunogen

Amino acids 131-164 (KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ) from the human protein were used as the immunogen for the GAD65 antibody.

Storage

After reconstitution, the GAD65 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all GAD65 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.