- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
GAD65 Antibody for WB (R32760)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
R32760 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Host | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| UniProt | Q05329 |
| Localization | Cytoplasmic, membranous |
| Applications | Western Blot : 0.5-1ug/ml IHC (FFPE) : 1-2ug/ml |
| Limitations | This GAD65 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Glutamate decarboxylase 2 is a pyridoxal phosphate-dependent enzyme encoded by the GAD2 gene and commonly referred to as GAD65. The GAD65 Antibody for WB is developed for detection of this key gamma-aminobutyric acid synthesizing enzyme in immunoblot-based protein expression studies. GAD2 is located on chromosome 10p11.23 and encodes the 65 kDa isoform of glutamate decarboxylase responsible for catalyzing the conversion of glutamate to gamma-aminobutyric acid, the principal inhibitory neurotransmitter in the central nervous system.
GAD65 is predominantly expressed in GABAergic neurons and is localized to the cytoplasmic face of synaptic vesicle membranes. In western blot applications, GAD65 is typically detected as a band near its predicted molecular weight of approximately 65 kDa. Signal intensity is commonly strongest in brain-derived lysates, particularly cortex, hippocampus, and cerebellum, reflecting the enrichment of inhibitory interneurons in these tissues. Non-neuronal tissues generally demonstrate minimal or absent signal, which supports interpretation of specificity in comparative immunoblot analyses.
Because GAD65 associates with membrane compartments, efficient extraction may depend on detergent composition and lysis conditions. In some preparations, minor band heterogeneity can be observed due to post-translational modifications or partial proteolysis, but the predominant immunoreactive species corresponds to the expected size of GAD2. Western blot detection is frequently used to compare neuronal versus non-neuronal samples, validate expression in engineered cell systems, or assess changes in inhibitory neuron-associated protein levels under experimental conditions.
In addition to its central nervous system enrichment, GAD2 is expressed in pancreatic islet beta cells, where it participates in local GABA signaling and functions as a major autoantigen in type 1 diabetes research. Immunoblot-based detection of GAD65 supports studies examining excitatory-inhibitory balance, synaptic protein regulation, and neuroendocrine cell characterization. Use of a GAD65 antibody for WB provides a reliable approach for confirming presence and relative abundance of this inhibitory neurotransmitter-synthesizing enzyme in brain and islet-derived samples.
Optimal dilution of the GAD65 antibody for WB should be determined by the researcher.
Amino acids 131-164 (KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ) from the human protein were used as the immunogen for the GAD65 antibody.
After reconstitution, the GAD65 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
