- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Glutamate decarboxylase 2 (GAD2), commonly known as GAD65, is a pyridoxal phosphate-dependent neuronal enzyme responsible for synthesis of gamma-aminobutyric acid (GABA), the major inhibitory neurotransmitter within the central nervous system. GAD2 localizes predominantly to presynaptic and synaptic vesicle-associated compartments where it supports activity-dependent GABA production required for inhibitory neurotransmission and synaptic signaling regulation. GAD2 Antibody is useful for investigations involving inhibitory neurotransmitter biology, synaptic signaling pathways, interneuron differentiation, and GABAergic neural circuit organization.
GAD2 antibody, also referred to as GAD65 antibody and Glutamate decarboxylase 65 antibody in the literature, recognizes a neuronal enzyme encoded on chromosome 10p11.23. GAD2 is highly enriched within inhibitory interneurons and presynaptic neural compartments throughout cortical and subcortical brain regions. Expression of GAD2 has been associated with inhibitory synaptic signaling, neuronal activity-dependent neurotransmitter release, autoimmune neurologic disease, epilepsy, neurodevelopmental disorders, and synaptic dysfunction-associated pathology.
GAD2 Antibody / Glutamate Decarboxylase 2 Antibody is uniquely positioned for studies involving inhibitory synaptic neurotransmission and GABAergic neuronal signaling pathways. This mouse monoclonal antibody, clone 7G2, supports detection of GAD2-associated inhibitory neurotransmitter synthesis pathways in neural tissues and neuronal cellular populations.
GAD2 contributes directly to inhibitory synaptic transmission through regulated synthesis of GABA linked to synaptic vesicle cycling and neuronal activity-dependent neurotransmitter release. Because GAD2 expression is highly associated with inhibitory synapses and GABAergic neuronal populations, it serves as an important marker for studies involving inhibitory neural circuitry, synaptic neurotransmission, and interneuron-associated signaling pathways. Altered GAD2 expression has additionally been associated with autoimmune neurologic disease and neural dysfunction-associated signaling abnormalities.
In tissue-based and cellular detection systems, GAD2 expression commonly demonstrates cytoplasmic and synaptic-associated localization patterns consistent with inhibitory neuronal signaling activity. Neural tissues enriched for inhibitory interneurons may demonstrate strong GAD2-associated staining reflecting active GABA synthesis pathways and inhibitory synaptic organization. GAD2-associated signaling networks are essential for maintenance of neural circuit balance and suppression of excitotoxic neuronal activity.
This GAD2 Antibody supports research involving GABA synthesis, inhibitory neurotransmitter signaling, synaptic neurotransmission pathways, interneuron differentiation, neural circuit organization, neurodevelopment-associated signaling, and GABAergic neuronal biology. The antibody may be incorporated into tissue-based and cellular investigations examining inhibitory neural signaling pathways in normal and diseased tissues.
For highly specific detection of GAD65 in inhibitory synaptic signaling studies, see our GAD65 Antibody / Synaptic GABA Marker Antibody page featuring clone GAD2/2362 with strong HuProt(TM) microarray specificity validation data.
Optimal dilution of the GAD2 Antibody / Glutamate Decarboxylase 2 Antibody should be determined by the researcher.
Amino acids KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ from the human protein were used as the immunogen for the GAD2 antibody mouse monoclonal 7G2.
After reconstitution, the GAD2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
GAD2 antibody, GAD65 antibody, Glutamate decarboxylase 2 antibody, Glutamate decarboxylase 65 antibody, GABA synthesis enzyme antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.