- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
FUT1 Antibody / Blood Group H Antigen Enzyme Antibody recognizes Fucosyltransferase 1 (FUT1), a Golgi-associated glycosyltransferase that catalyzes the transfer of fucose residues to precursor oligosaccharides during glycoprotein and glycolipid biosynthesis. Fucosyltransferase 1 is the principal enzyme responsible for generation of the blood group H antigen, a carbohydrate structure that serves as the essential precursor for synthesis of the A and B blood group antigens of the ABO system. Through its role in terminal glycosylation reactions, FUT1 regulates the composition of cell surface glycoconjugates and contributes to numerous biological processes involving cellular recognition, adhesion, signaling, and tissue organization. Because glycosylation profoundly influences protein function and cell-cell communication, FUT1 remains an important target in glycobiology, immunology, and cell biology research.
Fucosyltransferase 1 is primarily localized within the Golgi apparatus, where it transfers fucose from GDP-fucose donor molecules onto specific glycan acceptors. The resulting fucosylated structures participate in a wide variety of physiological processes including blood group antigen expression, epithelial differentiation, host-pathogen interactions, and regulation of cellular signaling pathways. FUT1 is especially important in tissues expressing ABO-related carbohydrate antigens, where synthesis of the H antigen provides the substrate required for subsequent modification by A and B transferases. As a result, Fucosyltransferase 1 occupies a central position within the biosynthetic pathway governing ABO blood group antigen expression and carbohydrate antigen diversity.
Beyond its established role in blood group antigen biosynthesis, Fucosyltransferase 1 contributes to regulation of cellular behavior through modification of membrane-associated glycoproteins and glycolipids. Altered fucosylation can influence receptor activation, cell adhesion properties, intracellular signaling events, and interactions between cells and the extracellular environment. Researchers frequently investigate FUT1 expression when studying glycan biosynthesis, developmental biology, epithelial cell differentiation, and mechanisms governing cell surface antigen regulation. The enzyme has therefore become an important marker for understanding how carbohydrate modifications influence cellular physiology and tissue-specific biological functions.
Altered Fucosyltransferase 1 expression has also been associated with cancer progression and disease-related changes in glycan biosynthesis. Abnormal fucosylation patterns are frequently observed in malignant tissues and may influence tumor growth, invasion, metastatic potential, and interactions with the tumor microenvironment. Consequently, FUT1 is often evaluated in studies examining cancer-associated glycosylation, tumor cell adhesion, and mechanisms linking carbohydrate antigen expression to disease progression. The enzyme remains an important target for investigating how cell surface glycans contribute to both normal physiology and pathological processes.
At NSJ Bioreagents, we provide highly validated antibodies for glycobiology, immunology, cancer research, and cell biology applications. FUT1 Antibody / Blood Group H Antigen Enzyme Antibody is useful for investigating Fucosyltransferase 1 expression, blood group H antigen biosynthesis, glycan-mediated signaling, cellular adhesion, and disease-associated alterations in glycosylation. Continued research into FUT1 is expanding our understanding of how carbohydrate modifications influence immune function, tissue organization, cellular communication, and human disease.
FUT1 regulates blood group H antigen biosynthesis and cell surface fucosylation, making it an important target within our Cell Biology Antibodies collection.
Optimal dilution of the FUT1 Antibody / Blood Group H Antigen Enzyme Antibody should be determined by the researcher.
Amino acids EVDSRTPWRELQLHDWMSEEYADLRDPFLKL of human FUT1 were used as the immunogen for the FUT1 antibody.
After reconstitution, the FUT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Fucosyltransferase 1 Antibody, Blood Group H Antigen Enzyme Antibody, Alpha(1,2)-Fucosyltransferase Antibody, H Antigen Synthase Antibody, Glycosyltransferase FUT1 Antibody, ABO Precursor Antigen Enzyme Antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.