• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> FRA1 Antibody / Fos-related antigen 1

FRA1 Antibody / Fos-related antigen 1 (RQ4426)

  Catalog No Formulation Size Price (USD)  
Image RQ4426 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human A375 cell lysate with FRA1 antibody at 0.5ug/ml. Predicted molecular weight ~29 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P15407
Applications Western Blot : 0.5-1ug/ml
Limitations This FRA1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Cow, Dog, Mouse, Pig, Rat

Description

Fos-related antigen 1 (FRA1) is a protein that in humans is encoded by the FOSL1 gene. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.

Application Notes

Optimal dilution of the FRA1 antibody should be determined by the researcher.

Immunogen

Amino acids QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH from the human protein were used as the immunogen for the FRA1 antibody.

Storage

After reconstitution, the FRA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.