• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> FGF9 Antibody

FGF9 Antibody (RQ4461)

  Catalog No Formulation Size Price (USD)  
Image RQ4461 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) human COLO-320, 2) rat brain and 3) mouse brain lysate with FGF9 antibody at 0.5ug/ml. Predicted molecular weight ~23 kDa with a possible 45-55 kDa dimer.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P31371
Localization Secreted
Applications Western Blot : 0.5-1ug/ml
Limitations This FGF9 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : IHC, FACS, WB
    Reactivity : Human, Mouse

Description

FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling.

Application Notes

Optimal dilution of the FGF9 antibody should be determined by the researcher.

Immunogen

Amino acids DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY were used as the immunogen for the FGF9 antibody.

Storage

After reconstitution, the FGF9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.