- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
FGF9 Antibody (RQ4461)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
RQ4461 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | P31371 |
| Localization | Secreted |
| Applications | Western blot : 0.5-1ug/ml |
| Limitations | This FGF9 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
FGF 9, Fibroblast growth factor 9, is a protein that in humans is encoded by the FGF9 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. The FGF 9 gene contains 3 exons. By radioactive chromosomal in situ hybridization, the FGF 9 gene is mapped to chromosome 13q11-q12. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling.
Optimal dilution of the FGF9 antibody should be determined by the researcher.
Amino acids DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY were used as the immunogen for the FGF9 antibody.
After reconstitution, the FGF9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz