• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> FABP2 Antibody

FABP2 Antibody (R32378)

  Catalog No Formulation Size Price (USD)  
Image R32378 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
FABP2 Antibody SW620 Cell WB. Western blot testing of human SW620 cell lysate with FABP2 antibody. Expected/observed molecular weight ~15 kDa.
FABP2 Antibody Intestinal Cancer IHC. Immunohistochemistry testing of FFPE human intestinal cancer tissue with FABP2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.
FABP2 Antibody Mouse Intestine IHC. Immunohistochemistry testing of FFPE mouse intestine with FABP2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.
FABP2 Antibody Rat Intestine IHC. Immunohistochemistry testing of FFPE rat intestine with FABP2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P12104
Localization Cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This FABP2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

FABP2 Antibody detects Fatty Acid Binding Protein 2. FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.

Researchers seeking a broadly validated FABP2 antibody for intestinal epithelial biology and lipid absorption studies may also be interested in our HuProt-validated FABP2 antibody clone FABP2/6344, supported by western blot, immunohistochemistry, and protein microarray specificity data.

Application Notes

Optimal dilution of the FABP2 antibody should be determined by the researcher.

Immunogen

Amino acids AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK from the human protein were used as the immunogen for the FABP2 antibody.

Storage

After reconstitution, the FABP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.