- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
FABP Antibody Rabbit Polyclonal recognizes Liver fatty acid binding protein, also known as FABP1, a cytoplasmic lipid chaperone encoded by the FABP1 gene on chromosome 2p11.2. Liver fatty acid binding protein is abundantly expressed in hepatocytes and is a member of the fatty acid binding protein family, which regulates intracellular trafficking of long chain fatty acids and other hydrophobic ligands. FABP1 is sometimes referred to as L-FABP and plays a central role in hepatic lipid metabolism and transport.
Liver fatty acid binding protein belongs to a conserved family of small approximately 14 kDa cytoplasmic proteins characterized by a beta barrel structure that forms a hydrophobic ligand binding pocket. FABP1 binds long chain fatty acids, eicosanoids, bile acids, and other lipophilic molecules, facilitating their intracellular solubilization and transport to specific metabolic pathways. In hepatocytes, FABP1 participates in fatty acid uptake, beta oxidation, triglyceride synthesis, and regulation of lipid mediated signaling pathways.
In normal tissues, FABP1 expression is highest in liver, where it is strongly localized to the cytoplasm of hepatocytes. Lower levels of expression have been reported in kidney proximal tubule epithelium and small intestinal enterocytes. Because of its restricted and abundant hepatic expression, FABP Antibody Rabbit Polyclonal is frequently used in research to identify hepatocellular differentiation and to study metabolic regulation in liver tissue. Cytoplasmic staining in hepatocytes is the expected localization pattern.
Altered FABP1 expression has been associated with metabolic disorders, fatty liver disease, and hepatocellular carcinoma. Changes in FABP1 levels have been investigated in the context of lipid accumulation, oxidative stress, and liver injury. FABP1 also serves as a potential biomarker in studies of liver function and hepatocyte integrity. FABP Antibody Rabbit Polyclonal (liver form) is suitable for detecting Liver fatty acid binding protein expression in relevant research applications focused on hepatic biology and lipid metabolism.
Optimal dilution of the FABP antibody should be determined by the researcher.
Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody rabbit polyclonal.
After reconstitution, the FABP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.