- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Exportin-5 Antibody (N-Terminal Region) (R32934)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32934 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| UniProt | Q9HAV4 |
| Applications | Western Blot : 0.5-1ug/ml |
| Limitations | This Exportin-5 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.
Optimal dilution of the Exportin-5 antibody should be determined by the researcher.
Amino acids 2-43 (AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK) were used as the immunogen for the Exportin-5 antibody.
After reconstitution, the Exportin-5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz