- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
EWSR1 Antibody / RNA Binding Protein Antibody recognizes EWSR1, a multifunctional RNA-binding protein belonging to the FET family of nucleic acid-binding proteins, which also includes FUS and TAF15. EWSR1 participates in numerous aspects of gene expression by coupling transcription with RNA processing, transport, and maturation. The protein contains an amino-terminal transcriptional activation domain and a carboxyl-terminal RNA-binding domain, allowing it to interact with both transcriptional machinery and RNA molecules. EWSR1 is expressed in many tissues and is predominantly localized within the nucleus under normal physiological conditions. A EWSR1 Antibody is widely used to investigate transcriptional regulation, RNA metabolism, DNA repair, and mechanisms governing cellular homeostasis.
EWSR1 serves as an important regulator of RNA biology through interactions with RNA polymerase II, splicing factors, transcription factors, and numerous RNA-binding proteins. It contributes to transcriptional activation, alternative RNA splicing, messenger RNA transport, and maintenance of genome stability following DNA damage. More recently, EWSR1 has also been implicated in biomolecular condensate formation through liquid-liquid phase separation, a process that helps organize nuclear functions and regulate gene expression. Because of these diverse activities, EWSR1 has become an important model for understanding how transcription and RNA processing are coordinated within the cell. A EWSR1 Antibody provides researchers with a valuable tool for investigating these interconnected molecular pathways.
EWSR1 is best known clinically because chromosomal translocations involving the gene generate oncogenic fusion proteins that drive multiple human sarcomas and related malignancies. The most common fusion, EWSR1-FLI1, is the defining molecular alteration in Ewing sarcoma, while additional fusion partners have been identified in desmoplastic small round cell tumor, myxoid liposarcoma, clear cell sarcoma, extraskeletal myxoid chondrosarcoma, and several other neoplasms. Beyond oncology, EWSR1 has been linked to neurodegenerative disease, cellular stress responses, and DNA damage repair through its normal physiological functions. Consequently, a EWSR1 Antibody is widely applied in cancer biology, molecular pathology, neuroscience, and RNA biology research.
EWSR1 is routinely analyzed using Western blot, immunohistochemistry, immunofluorescence, immunoprecipitation, and flow cytometry to evaluate protein expression, intracellular localization, and regulation in normal and diseased tissues. Researchers frequently combine EWSR1 detection with markers of transcription, RNA splicing, DNA repair, or oncogenic fusion proteins to obtain a broader understanding of gene regulation and tumor biology. NSJ Bioreagents provides carefully validated antibodies to support these applications across multiple experimental systems. An EWSR1 Antibody / RNA Binding Protein Antibody is a valuable research reagent for investigating transcriptional regulation, RNA metabolism, genome stability, oncogenic gene fusions, and the molecular mechanisms underlying normal cellular function and human disease.
Explore our Transcription Factor Antibodies page to discover validated antibodies for EWSR1 and other proteins involved in transcriptional regulation, RNA processing, gene expression, genome stability, and oncogenic gene fusion research.
Optimal dilution of the EWSR1 Antibody / RNA Binding Protein Antibody should be determined by the researcher.
Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.
After reconstitution, the EWSR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
EWSR1 antibody, RNA Binding Protein antibody, EWS antibody, Ewing Sarcoma Breakpoint Region 1 antibody, Ewing Sarcoma Protein antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.