• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> EWSR1 Antibody / EWS

EWSR1 Antibody / EWS (R32181)

  Catalog No Formulation Size Price (USD)  
Image R32181 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
ICC staining of FFPE human SMMC-7721 cells with EWSR1 antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human breast cancer tissue with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of frozen human placental tissue with EWSR1 antibody at 1ug/ml.
IHC staining of frozen mouse intestinal tissue with EWSR1 antibody at 1ug/ml.
IHC staining of frozen rat intestinal tissue with EWSR1 antibody at 1ug/ml.
Immunofluorescent staining of FFPE human U-2 OS cells with EWSR1 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) K562, 3) Jurkat, 4) HL60 and 5) HEK293 cell lysate with EWSR1 antibody. Predicted molecular weight: ~69 kDa, but routinely observed at ~90 kDa.
Flow cytometry testing of human U-2 OS cells with EWSR1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EWSR1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q01844
Localization Nuclear
Applications Western Blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunohistochemistry (Frozen) : 1-2ug/ml
Immunocytochemistry (FFPE) : 1-2ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This EWSR1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Pig, Cow

Description

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Application Notes

Optimal dilution of the EWSR1 antibody should be determined by the researcher.

Immunogen

Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.

Storage

After reconstitution, the EWSR1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.