• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ERp57 Antibody / PDIA3

ERp57 Antibody / PDIA3 [clone 7E5.] (RQ7021)

  Catalog No Formulation Size Price (USD)  
Image RQ7021 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC staining of FFPE human rectal cancer tissue with ERp57 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) placenta, 2) A549, 3) SW620, 4) HEK293, 5) K562 and 6) Raji cell lysate with ERp57 antibody. Predicted molecular weight: ~57-60 kDa.
Flow cytometry testing of human U-87 MG cells with ERp57 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ERp57 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 7E5.
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P30101
Localization Cytoplasmic
Applications Western Blot : 0.5-1 ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This ERp57 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, IHC-F, IF/ICC, FACS
    Reactivity : Human, Mouse, Rat

Description

PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.

Application Notes

Optimal dilution of the ERp57 antibody should be determined by the researcher.

Immunogen

C-terminal amino acids RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL were used as the immunogen for the ERp57 antibody.

Storage

After reconstitution, the ERp57 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.