- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
ERBB4 Antibody / HER4 (RQ4013)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
RQ4013 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Host | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | Q15303 |
| Localization | Cytoplasmic, nuclear |
| Applications | Western Blot : 0.5-1ug/ml Immunohistochemistry (FFPE) : 1-2ug/ml |
| Limitations | This ERBB4 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
ERBB4 antibody recognizes Erb-B2 receptor tyrosine kinase 4, commonly known as HER4, a member of the epidermal growth factor receptor family of receptor tyrosine kinases. ERBB4 antibody, also referred to as HER4 antibody and ErbB4 antibody in the literature, detects a transmembrane receptor involved in growth factor-mediated signaling, cellular differentiation, and survival regulation. ERBB4 functions as a ligand-activated receptor that contributes to both developmental processes and tumor-associated signaling pathways.
HER4 belongs to the ERBB receptor family, which includes EGFR, HER2, and HER3. Upon binding to ligands such as neuregulins and other EGF-like growth factors, HER4 undergoes receptor dimerization and autophosphorylation, initiating downstream signaling cascades including PI3K-AKT, MAPK, and JAK-STAT pathways. These pathways regulate proliferation, differentiation, apoptosis, and transcriptional activity across multiple tissue types. A distinguishing feature of HER4 is its ability to undergo regulated intramembrane proteolysis, releasing an intracellular domain that can translocate to the nucleus and influence gene expression.
The ERBB4 gene is located on chromosome 2q34 and produces multiple isoforms through alternative splicing. These isoforms differ in their cytoplasmic tail composition and signaling capacity, contributing to context-dependent biological effects. HER4 expression has been documented in mammary epithelium, neural tissue, cardiac muscle, and other epithelial tissues, where it plays roles in development and tissue homeostasis.
Dysregulation of ERBB4 signaling has been implicated in breast cancer, ovarian carcinoma, and additional malignancies. Depending on isoform distribution and cellular environment, HER4 has been associated with both differentiation-promoting and tumor-modulating functions. Evaluation of ERBB4 expression is therefore relevant in studies of receptor tyrosine kinase biology and cancer-associated signaling networks.
ERBB4 antibody is suitable for research applications focused on HER4 signaling, ERBB pathway analysis, and molecular investigation of receptor tyrosine kinase-mediated growth regulation.
For detection of total HER4 expression, see our HER4 antibody page.
Optimal dilution of the ERBB4 antibody should be determined by the researcher.
Amino acids SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR from the human protein were used as the immunogen for the ERBB4 antibody.
After reconstitution, the ERBB4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
