• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> EPHB1 Antibody / Eph Receptor B1

EPHB1 Antibody / Eph Receptor B1 (R32141)

  Catalog No Formulation Size Price (USD)  
Image R32141 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC testing of FFPE human glioma tissue with EPHB1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) human U-251, 2) human HEL, 3) rat testis, 4) rat brain, 5) mouse testis and 6) mouse brain tissue lysate with EPHB1 antibody. Expected/observed molecular weight ~111 kDa.
Flow cytometry testing of human U-2 OS cells with EPHB1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EPHB1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P54762
Localization Cytoplasmic, membrane
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This EPHB1antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

Application Notes

Optimal dilution of the EPHB1 antibody should be determined by the researcher.

Immunogen

Amino acids RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE of human Eph receptor B1 were used as the immunogen for the EPHB1 antibody.

Storage

After reconstitution, the EPHB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.