• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Emerin Antibody

Emerin Antibody [clone 5A10] (RQ4516)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4516 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) placenta, 3) Caco-2, 4) HepG2, 5) Rabbit IgG, 6) marker, 7) Jurkat, 8) MDA-MB-453, 9) SK-OV-3 and 10) U-87 MG lysate with Emerin antibody at 0.5ug/ml. Expected molecular weight: 29-34 kDa.
›
Western blot testing of human 1) HeLa, 2) placenta, 3) Caco-2, 4) HepG2, 5) Rabbit IgG, 6) marker, 7) Jurkat, 8) MDA-MB-453, 9) SK-OV-3 and 10) U-87 MG lysate with Emerin antibody at 0.5ug/ml. Expected molecular weight: 29-34 kDa.
IHC testing of FFPE human gastric cancer with Emerin antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human rectal cancer with Emerin antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Availability 1-3 business days
Species Reactivity Human
Format Purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 5A10
Purity Protein G affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P50402
Localization Nuclear membrane
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This Emerin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IF, IHC-P
    Reactivity : Human
    Microvalidated
  • Applications : WB, IHC-P
    Reactivity : Human
    Microvalidated
  • Applications : WB, IHC-P, IF/ICC, FACS
    Reactivity : Human, Mouse, Rat

Description

Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta- catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Required for proper localization of non-farnesylated prelamin-A/C. [UniProt]

Application Notes

Optimal dilution of the Emerin antibody should be determined by the researcher.

Immunogen

Amino acids MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL were used as the immunogen for the Emerin antibody.

Storage

After reconstitution, the Emerin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Emerin antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.