- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.
Optimal dilution of the EME1 antibody should be determined by the researcher.
Amino acids DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ of human EME1 were used as the immunogen for the EME1 antibody.
After reconstitution, the EME1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.