• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Elongation factor 2 Antibody / EEF2

Elongation factor 2 Antibody / EEF2 (RQ6253)

Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ6253 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of rat 1) kidney, 2) lung, 3) stomach, 4) C6 and mouse 5) kidney, 6) lung, 7) stomach and 8) NIH 3T3 cell lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.
›
Western blot testing of rat 1) kidney, 2) lung, 3) stomach, 4) C6 and mouse 5) kidney, 6) lung, 7) stomach and 8) NIH 3T3 cell lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.
Western blot testing of 1) human Jurkat, 2) monkey COS-7 and human 3) HeLa, 4) U-2 OS, 5) HEK293, 6) HepG2 and 7) placenta lysate with Elongation factor 2 antibody. Predicted molecular weight ~95 kDa.
IHC staining of FFPE human gastric cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human rectal cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human prostate cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human esophageal squamous carcinoma tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain tissue with Elongation factor 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A431 cells with Elongation factor 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U937 cells with Elongation factor 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Elongation factor 2 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat, Monkey
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P13639
Localization Cytoplasmic, nuclear
Applications Western blot : 1-2ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence : 5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This Elongation factor 2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Application Notes

Optimal dilution of the Elongation factor 2 antibody should be determined by the researcher.

Immunogen

Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.

Storage

After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Elongation factor 2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.