• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> DNA Polymerase iota Antibody / POLI

DNA Polymerase iota Antibody / POLI (RQ4298)

  Catalog No Formulation Size Price (USD)  
Image RQ4298 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HeLa, 2) placenta, 3) A549 and 4) SK-OV-3 lysate with DNA Polymerase iota antibody at 0.5ug/ml. Predicted molecular weight ~83 kDa.
Western blot testing of rat 1) testis, 2) testis, 3) kidney, 4) stomach and mouse 5) testis, 6) testis, 7) kidney and 8) stomach lysate with DNA Polymerase iota antibody at 0.5ug/ml. Predicted molecular weight ~83 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9UNA4
Localization Nucleus
Applications Western Blot : 0.5-1ug/ml
Limitations This DNA Polymerase iota antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion.

Application Notes

Optimal dilution of the DNA Polymerase iota antibody should be determined by the researcher.

Immunogen

Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody.

Storage

After reconstitution, the DNA Polymerase iota antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.