• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> DHODH Antibody / Dihydroorotate dehydrogenase

DHODH Antibody / Dihydroorotate dehydrogenase [clone 4E3.] (RQ6591)

  Catalog No Formulation Size Price (USD)  
Image RQ6591 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Immunofluorescent staining of FFPE human MCF7 cells with DHODH antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HeLa, 2) human A431, 3) human HepG2, 4) human MCF7, 5) rat testis, 6) rat liver, 7) mouse testis and 8) mouse liver tissue lysate with DHODH antibody. Predicted molecular weight ~43 kDa.
Flow cytometry testing of human U937 cells with DHODH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DHODH antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 4E3.
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q02127
Localization Cytoplasmic, nuclear
Applications Western Blot : 1-2ug/ml
Immunofluorescence (FFPE) : 5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This DHODH antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat

Description

Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.

Application Notes

Optimal dilution of the DHODH antibody should be determined by the researcher.

Immunogen

N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED from the human protein were used as the immunogen for the DHODH antibody.

Storage

After reconstitution, the DHODH antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.