• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> DDAH1 Antibody

DDAH1 Antibody (R32437)

  Catalog No Formulation Size Price (USD)  
Image R32437 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat kidney, 2) mouse kidney and 3) human HeLa lysate with DDAH1 antibody at 0.5ug/ml. Expected molecular weight: 31-38 kDa.
IHC staining of FFPE mosue brain with DDAH1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat brain with DDAH1 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human A431 cells with DDAH1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DDAH1 antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with DDAH1 antibody (red) and DAPI nuclear stain (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O94760
Localization Cytoplasmic
Applications Western Blot : 0.5-1ug/ml (mouse/rat); 2-4ug/ml (human)
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow Cytometry : 1-3ug/million cells
Immunofluorescence : 2-4ug/ml
Limitations This DDAH1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Cow
  • Applications : IF, WB, FACS, IHC-P
    Reactivity : Human, Mouse

Description

DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.

Application Notes

Optimal dilution of the DDAH1 antibody should be determined by the researcher.

Immunogen

Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN were used as the immunogen for the DDAH1 antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the DDAH1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.