• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Cytochrome P450 Reductase Antibody / POR / CYPOR

Cytochrome P450 Reductase Antibody / POR / CYPOR [clone 7F5] (RQ6592)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ6592 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
IHC staining of FFPE human esophageal squamous carcinoma tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
›
IHC staining of FFPE human esophageal squamous carcinoma tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HepG2 and 2) A549 cell lysate with Cytochrome P450 Reductase antibody. Predicted molecular weight: ~77 kDa.
Flow cytometry testing of human SiHa cells with Cytochrome P450 Reductase antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cytochrome P450 Reductase antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 7F5
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P16435
Localization Cytoplasmic, cell membrane
Applications Western blot : 1-2ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This Cytochrome P450 Reductase antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Application Notes

Optimal dilution of the Cytochrome P450 Reductase antibody should be determined by the researcher.

Immunogen

C-terminal region amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK from the human protein were used as the immunogen for the Cytochrome P450 Reductase antibody.

Storage

After reconstitution, the Cytochrome P450 Reductase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all POR antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.