• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CXCR7 Antibody

CXCR7 Antibody (RQ7428)

  Catalog No Formulation Size Price (USD)  
Image RQ7428 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC staining of FFPE human urothelial carcinoma tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human endometrial cancer tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colon adenocarcinoma tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human tonsil tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) RT4 and 2) HeLa cell lysate with CXCR7 antibody. Predicted molecular weight ~43 kDa.
Flow cytometry testing of human SiHa cells with CXCR7 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CXCR7 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P25106
Localization Cell membrane, cytoplasm
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This CXCR7 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC, WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human

Description

Atypical chemokine receptor 3 also known as C-X-C chemokine receptor type 7 (CXCR-7) and G-protein coupled receptor 159 (GPR159) is a protein that in humans is encoded by the ACKR3 gene. This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.

Application Notes

Optimal dilution of the CXCR7 antibody should be determined by the researcher.

Immunogen

Amino acids RNYRYELMKAFIFKYSAKTGLTKLIDASRVSE from the human protein were used as the immunogen for the CXCR7 antibody.

Storage

After reconstitution, the CXCR7 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.