• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CXCR4 Antibody

CXCR4 Antibody (R32743)

  Catalog No Formulation Size Price (USD)  
Image R32743 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human HeLa cell lysate with CXCR4 antibody at 0.5ug/ml. Predicted molecular weight ~40 kDa but may be observed at higher molecular weights due to glycosylation.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P61073
Applications Western Blot : 0.5-1ug/ml
Limitations This CXCR4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Mouse, Pig, Primate, Rat
  • Applications : WB, Direct ELISA
    Reactivity : Human
  • Applications : WB, FACS, Direct ELISA
    Reactivity : Human
  • Applications : WB, FACS, Direct ELISA
    Reactivity : Human, Mouse, Rat

Description

CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

Application Notes

Optimal dilution of the CXCR4 antibody should be determined by the researcher.

Immunogen

Amino acids 265-294 (ILLEIIKQGCEFENTVHKWISITEALAFFH) from the human protein were used as the immunogen for the CXCR4 antibody.

Storage

After reconstitution, the CXCR4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.