• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CRB1 Antibody

CRB1 Antibody (RQ5239)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ5239 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
›
Western blot testing of human 1) HEK293 and 2) U-87 MG cell lysate with CRB1 antibody. Predicted molecular weight ~154 kDa.
Flow cytometry testing of human U-87 MG cells with CRB1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CRB1 antibody.
IHC staining of FFPE human testis cancer with CRB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE mouse testis with CRB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat testis with CRB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human glioma with CRB1 antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P82279
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This CRB1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

Application Notes

Optimal dilution of the CRB1 antibody should be determined by the researcher.

Immunogen

Amino acids FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ from the human protein were used as the immunogen for the CRB1 antibody.

Storage

Store the CRB1 antibody at -20oC.

Related Products

   1.   View all CRB1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.