• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Connexin 46 Antibody / GJA3

Connexin 46 Antibody / GJA3 (R32368)

  Catalog No Formulation Size Price (USD)  
Image R32368 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat heart, 2) rat kidney, 3) human placenta, 4) mouse NIH3T3 lysate with Connexin 46 antibody. Predicted molecular weight ~46 kDa but can be observed 5-10 kDa higher (Ref 1).
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9Y6H8
Applications Western Blot : 0.1-0.5ug/ml
Limitations This Connexin 46 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).

Application Notes

Optimal dilution of the Connexin 46 antibody should be determined by the researcher.

Immunogen

Amino acids TLIYLGHVLHIVRMEEKKKEREEEEQLKRE of human GJA3/Connexin 46 were used as the immunogen for the Connexin 46 antibody.

Storage

After reconstitution, the Connexin 46 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.