• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> CK19 Antibody / Cytokeratin 19

CK19 Antibody / Cytokeratin 19 (R31920)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31920 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) placenta, 2) MCF7, 3) SW620, 4) COLO-320, 5) HepG2 and 6) PANC-1 lysate with CK19 antibody. Expected molecular weight ~43 kDa.
›
Western blot testing of human 1) placenta, 2) MCF7, 3) SW620, 4) COLO-320, 5) HepG2 and 6) PANC-1 lysate with CK19 antibody. Expected molecular weight ~43 kDa.
Western blot testing of 1) rat lung, 2) rat small intestine, 3) mouse lung and 4) mouse HEPA1-6 lysate with CK19 antibody. Expected molecular weight ~43 kDa.
IHC testing of FFPE human lung cancer tissue with CK19 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human lung cancer tissue with CK19 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human lung cancer tissue with CK19 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse small intestine with CK19 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat small intestine with CK19 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE human colon cancer with CK19 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE human MCF7 cells with CK19 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human MCF7 cells with CK19 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CK19 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P08727
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemisty (FFPE) : 0.5-1ug/ml
Immunofluorescence : 5ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This CK19 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Cytokeratin 19, also called Keratin 19 and CK19, is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, CK19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.

Application Notes

Optimal dilution of the CK19 antibody should be determined by the researcher.

Immunogen

Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR of human KRT19 were used as the immunogen for the CK19 antibody.

Storage

After reconstitution, the CK19 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Cytokeratin 19 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.