• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CHRNA5 Antibody

CHRNA5 Antibody (R32708)

  Catalog No Formulation Size Price (USD)  
Image R32708 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat skeletal muscle and 2) human HepG2 lysate with CHRNA5 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa.
IHC testing of FFPE human prostate cancer tissue with CHRNA5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse heart tissue with CHRNA5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse intestine tissue with CHRNA5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat heart tissue with CHRNA5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat intestine tissue with CHRNA5 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Flow cytometry testing of human U-251 MG cells with CHRNA5 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA5 antibody.
Flow cytometry testing of human MCF7 cells with CHRNA5 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA5 antibody.
Flow cytometry testing of human A549 cells with CHRNA5 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA5 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P30532
Localization Cytoplasmic, membranous
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This CHRNA5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA (peptide)
    Reactivity : Human

Description

Neuronal acetylcholine receptor subunit alpha-5 is a protein that in humans is encoded by the CHRNA5 gene. It is mapped to 15q25.1. The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).

Application Notes

Optimal dilution of the CHRNA5 antibody should be determined by the researcher.

Immunogen

Amino acids 44-76 (AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF) from the human protein were used as the immunogen for the CHRNA5 antibody.

Storage

After reconstitution, the CHRNA5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.