• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CD5 Antibody

CD5 Antibody (RQ4028)

  Catalog No Formulation Size Price (USD)  
Image RQ4028 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 389
Western blot testing of 1) rat liver, 2) mouse HEPA1-6 and 3) human HeLa lysate with CD5 antibody at 0.5ug/ml. Observed molecular weight: 55~67 kDa depending on glycosylation level.
Flow cytometry testing of human PBMC with CD5 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CD5 antibody.
Western blot testing of 1) human Jurkat 2) human CCRF-CEM, 3) human MOLT-4, 4) rat thymus and 5) mouse thymus lysate with CD5 antibody at 0.5ug/ml. Observed molecular weight: 55~67 kDa depending on glycosylation level.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P06127
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This CD5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Application Notes

Optimal dilution of the CD5 antibody should be determined by the researcher.

Immunogen

Amino acids KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH from the human protein were used as the immunogen for the CD5 antibody.

Storage

After reconstitution, the CD5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.