• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CD38 Antibody

CD38 Antibody (RQ5801)

  Catalog No Formulation Size Price (USD)  
Image RQ5801 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC staining of FFPE human tonsil with CD38 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human appendicitis tissue with CD38 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer with CD38 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A431 cells with CD38 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human Raji lysate with CD38 antibody. Expected molecular weight: 34-46 kDa depending on glycosylation level.
Flow cytometry testing of human Raji cells with CD38 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD38 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P28907
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry : 1-2ug/ml
Immunofluorescence : 2-4ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This CD38 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The protein encoded by this gene is a non-lineage-restricted, type II transmembrane glycoprotein that synthesizes and hydrolyzes cyclic adenosine 5'-diphosphate-ribose, an intracellular calcium ion mobilizing messenger. The release of soluble protein and the ability of membrane-bound protein to become internalized indicate both extracellular and intracellular functions for the protein. This protein has an N-terminal cytoplasmic tail, a single membrane-spanning domain, and a C-terminal extracellular region with four N-glycosylation sites. Crystal structure analysis demonstrates that the functional molecule is a dimer, with the central portion containing the catalytic site. It is used as a prognostic marker for patients with chronic lymphocytic leukemia. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the CD38 antibody should be determined by the researcher.

Immunogen

Amino acids EVHNLQPEKVQTLEAWVIHGGREDSRDLCQD from the human protein were used as the immunogen for the CD38 antibody.

Storage

After reconstitution, the CD38 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.