- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
CD38 (CD38) is a type II transmembrane glycoprotein with ectoenzyme activity that regulates NAD metabolism and calcium signaling, and is prominently expressed on the surface of plasma cells, activated T and B lymphocytes, natural killer cells, and subsets of myeloid cells. Its tightly regulated surface expression varies with cellular activation and differentiation status, making CD38 a highly informative marker for resolving immune cell heterogeneity in flow cytometry-based analysis.
CD38 Antibody for FACS / CD38 Flow Cytometry Antibody is optimized for detection of CD38 on the cell surface, enabling precise identification, quantification, and isolation of CD38-positive populations in suspension-based assays. CD38 antibody, also known as cyclic ADP-ribose hydrolase antibody or ADPRC1 antibody, is widely incorporated into immunophenotyping panels where it supports discrimination of plasma cells, activated lymphocytes, and transitional immune subsets based on differential expression intensity.
In flow cytometry workflows, CD38 is most notably used to identify plasma cells, which display high-density surface expression and form a clearly separable CD38-bright population. This strong signal enables robust gating of plasma cells from surrounding lymphocyte populations, even in complex samples such as peripheral blood mononuclear cells or bone marrow aspirates. Activated B cells and T cells typically exhibit intermediate CD38 expression, while naïve or resting lymphocytes show low to minimal signal, creating a gradient of expression that supports multi-level population resolution.
CD38 is frequently used in combination with markers such as CD19, CD20, CD27, CD45, and CD138 to refine gating strategies and define specific immune subsets. For example, CD38-high populations in conjunction with B cell lineage markers support identification of plasma cells, while co-expression patterns with activation markers enable characterization of immune activation states. This makes CD38 an important component of multiparametric panels designed for detailed immune profiling and lineage tracking.
The surface accessibility of CD38 allows for staining of live, non-permeabilized cells, preserving cell viability and enabling downstream applications such as fluorescence-activated cell sorting. This is particularly advantageous for isolation of viable plasma cells or activated lymphocyte subsets for functional assays, transcriptomic analysis, or cell culture studies. The ability to detect CD38 without intracellular staining simplifies assay design and improves reproducibility in flow cytometry experiments.
In hematologic and immunology research, CD38 expression is commonly analyzed in bone marrow, peripheral blood, and lymphoid tissues to assess immune cell composition and differentiation status. Expanded CD38-positive populations are frequently observed in plasma cell disorders and other immune-related conditions, and flow cytometry provides a quantitative approach to evaluate these changes across large cell populations with high sensitivity.
The use of a rabbit polyclonal CD38 antibody provides broad epitope recognition, supporting strong and consistent detection of CD38 across cells with variable antigen density. This can enhance signal intensity and improve detection of dimly expressing populations, which is particularly important in heterogeneous samples where expression levels may span a wide range. The resulting staining profile supports clear separation of CD38-positive and CD38-negative populations during gating.
CD38 Flow Cytometry Antibody is therefore a powerful tool for immune cell phenotyping, population stratification, and cell sorting applications, enabling high-resolution analysis of plasma cells and activated lymphocyte subsets within complex biological samples.
This antibody is part of our CD38 antibody collection, which includes application-specific formats for immunohistochemistry, flow cytometry, western blot, and immunofluorescence research.
Optimal dilution of the CD38 Antibody for FACS / CD38 Flow Cytometry Antibody should be determined by the researcher.
Amino acids EVHNLQPEKVQTLEAWVIHGGREDSRDLCQD from the human protein were used as the immunogen for the CD38 antibody.
After reconstitution, the CD38 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
CD38 flow cytometry antibody, CD38 cell surface marker antibody, CD38 lymphocyte marker antibody, CD38 plasma cell marker antibody, CD38 immune activation marker antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.