• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CD229 Antibody / Ly9

CD229 Antibody / Ly9 (RQ4650)

  Catalog No Formulation Size Price (USD)  
Image RQ4650 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC staining of FFPE mouse spleen with CD229 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse spleen with CD229 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat spleen with CD229 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat spleen with CD229 antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Flow cytometry testing of human Daudi cells with CD229 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD229 antibody.
Flow cytometry testing of human Jurkat cells with CD229 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD229 antibody.
Flow cytometry testing of human U937 cells with CD229 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD229 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9HBG7
Localization Plasma membrane, cytoplasm
Applications IHC (FFPE) : 1-2ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Review this product on BioCompare and get a $20 Amazon gift card

Description

T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.

Application Notes

Optimal dilution of the CD229 antibody should be determined by the researcher.

Immunogen

Amino acids YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK were used as the immunogen for the CD229 antibody.

Storage

After reconstitution, the CD229 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.