- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.
Optimal dilution of the CCR3 antibody should be determined by the researcher.
Amino acids MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA were used as the immunogen for the CCR3 antibody.
After reconstitution, the CCR3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.