• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CCNT1 Antibody / Cyclin-T1

CCNT1 Antibody / Cyclin-T1 [clone 3B7] (RQ6588)

  Catalog No Formulation Size Price (USD)  
Image RQ6588 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Flow cytometry testing of human U-2 OS cells with CCNT1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CCNT1 antibody.
Western blot testing of 1) human Jurkat, 2) human HeLa, 3) human SW620 and 4) monkey COS-7 cell lysate with CCNT1 antibody. Predicted molecular weight ~81 kDa.
Availability 1-3 business days
Species Reactivity Human, Monkey
Format Antigen affinity purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 3B7
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt O60563
Applications Western Blot : 1-2ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This CCNT1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, IF/ICC, FACS
    Reactivity : Human, Mouse, Rat
  • Applications : WB, FACS
    Reactivity : Human, Mouse

Description

Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the CCNT1 antibody should be determined by the researcher.

Immunogen

Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELQKRQLENM from the human protein were used as the immunogen for the CCNT1 antibody.

Storage

After reconstitution, the CCNT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.