• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Caspase-2 Antibody

Caspase-2 Antibody (R32097)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32097 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of 1) rat lung, 2) mouse liver, 3) human A549, 4) PANC and 5) 293 lysate with Caspase-2 antibody. Predicted molecular weight: ~47 kDa (full), ~31 kDa (large+small subunit), ~11 kDa (small subunit).
Western blot testing of 1) rat lung, 2) mouse liver, 3) human A549, 4) PANC and 5) 293 lysate with Caspase-2 antibody. Predicted molecular weight: ~47 kDa (full), ~31 kDa (large+small subunit), ~11 kDa (small subunit).
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P42575
Applications Western blot : 0.1-0.5ug/ml
Limitations This Caspase-2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, Direct ELISA
    Reactivity : Human, Mouse, Rat
  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC, FACS, ELISA
    Reactivity : Human

Description

CASP2 is equal to Caspase-2. And Caspase-2, which is involved in stress-induced apoptosis, is recruited into a large protein complex, the molecular composition of which remains elusive. It is showed that activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD. Increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli. Caspase-2 acts both as a positive and negative cell death effector, depending upon cell lineage and stage of development.

Application Notes

Optimal dilution of the Caspase-2 antibody should be determined by the researcher.

Immunogen

Amino acids RNTKRGSWYIEALAQVFSERACDMHVADMLVK of human Caspase-2 were used as the immunogen for the Caspase-2 antibody. This sequence is found on the small subunit.

Storage

After reconstitution, the Caspase-2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Caspase-2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.