- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
CASP2 is equal to Caspase-2. And Caspase-2, which is involved in stress-induced apoptosis, is recruited into a large protein complex, the molecular composition of which remains elusive. It is showed that activation of caspase-2 occurs in a complex that contains the death domain-containing protein PIDD, whose expression is induced by p53, and the adaptor protein RAIDD. Increased PIDD expression resulted in spontaneous activation of caspase-2 and sensitization to apoptosis by genotoxic stimuli. Caspase-2 acts both as a positive and negative cell death effector, depending upon cell lineage and stage of development.
Optimal dilution of the Caspase-2 antibody should be determined by the researcher.
Amino acids RNTKRGSWYIEALAQVFSERACDMHVADMLVK of human Caspase-2 were used as the immunogen for the Caspase-2 antibody. This sequence is found on the small subunit.
After reconstitution, the Caspase-2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.