- Tel: 858.663.9055
- 
									 Email: info@nsjbio.com Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
 Email: info@nsjbio.com
Email: info@nsjbio.com
								Related Products
| 
 | 
Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the Calcitonin antibody should be determined by the researcher.
Amino acids CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP were used as the immunogen for the Calcitonin antibody.
After reconstitution, the Calcitonin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
 
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.